Web stats for Koko - koko.co.il
בשמים KOKO Perfume בושם לאשה לגבר בושם לאישה במבצע מגוון קלווין קליין chanel בולגארי אליאן alien coco קוקו
1.67 Rating by ClearWebStats
This website has a #1,476,710 rank in global traffic. It has a .co.il as an domain extension. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, koko.co.il is SAFE to browse.
Traffic Report of Koko
Daily Unique Visitors: | 326 |
Daily Pageviews: | 652 |
Estimated Valuation
Income Per Day: | $ 2.00 |
Estimated Worth: | $ 480.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | 3 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 1,476,710 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
69
Siteadvisor Rating
Not Applicable
Where is koko.co.il server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 1 | Total Images: | 65 |
Google Adsense: | Not Applicable | Google Analytics: | UA-53425768-1 |
Websites Hosted on Same IP (i.e. 82.80.254.190)
קידום אתרים נטוורקינג | SEO Boots
- net-working.co.il
קידום אתרים מקצועי במנועי חיפוש - כל החברות, כל הפורומים, כל הכלים באתר אחד. מאמרים ודוגמאות למתעניינים בלימודי קידום אתרים
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 27 Nov 2014 10:47:31 GMT
Server: Microsoft-IIS/6.0
Content-Length: 56475
Content-Type: text/html
Cache-control: private
Status-Code: 200
Status: 200 OK
Date: Thu, 27 Nov 2014 10:47:31 GMT
Server: Microsoft-IIS/6.0
Content-Length: 56475
Content-Type: text/html
Cache-control: private
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
koko.co.il | A | 3599 |
IP:82.80.254.190 |
koko.co.il | NS | 3599 |
Target:ns3.srv.co.il |
koko.co.il | NS | 3599 |
Target:ns4.srv.co.il |
koko.co.il | SOA | 3599 |
MNAME:ns3.srv.co.il RNAME:domain.srv.co.il Serial:2006010226 Refresh:3600 Retry:600 Expire:1209600 |
koko.co.il | MX | 3599 |
Priority:10 Target:mail.koko.co.il |
koko.co.il | TXT | 3599 |
TXT:v=spf1 a mx ptr ~all |
koko.co.il | TXT | 3599 |
TXT:k=rsa; n=512; p=MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAP93DK WavoEkiY6TatIXDn5MdfTxsxWH0gbAGUiCCoWbgH AHbuRhHPuFUaMseA1b/70jSqYBbON1/S2QKQR46e 8CAwEAAQ== |
Similarly Ranked Websites to Koko
شركة كشف تسربات المياه بالرياض (الموقع للايجار
- companydetectleakswaterinriyadh.com
شركات كشف تسربات بالرياض بأحدث وسائل مع الإصلاح بالضمان,وإصلاح تسربات المياه كشف تسربات المياه فى الرياض بدون تكسير باحدث اجهزة في كشف تسرب الماء في الجدار من